Placeholder image of a protein
Icon representing a puzzle

1993: Revisiting Puzzle 64: Thioredoxin

Closed since almost 5 years ago

Novice Overall Prediction

Summary

Created
May 13, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 2 pts. 11,295
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 11,177
  3. Avatar for Team China 13. Team China 1 pt. 11,093
  4. Avatar for Australia 14. Australia 1 pt. 10,889
  5. Avatar for 104-Biology (2020) 15. 104-Biology (2020) 1 pt. 10,847
  6. Avatar for https://fold.it/portal/Chem445_2021 16. https://fold.it/portal/Chem445_2021 1 pt. 10,829
  7. Avatar for QCNMIT 17. QCNMIT 1 pt. 10,194
  8. Avatar for Ivy Tech CHEM 115 18. Ivy Tech CHEM 115 1 pt. 9,903
  1. Avatar for zannipietro 81. zannipietro Lv 1 3 pts. 11,188
  2. Avatar for ShadowTactics 82. ShadowTactics Lv 1 3 pts. 11,177
  3. Avatar for xythus 83. xythus Lv 1 3 pts. 11,174
  4. Avatar for alcor29 84. alcor29 Lv 1 3 pts. 11,109
  5. Avatar for Vinara 85. Vinara Lv 1 3 pts. 11,109
  6. Avatar for zo3xiaJonWeinberg 86. zo3xiaJonWeinberg Lv 1 3 pts. 11,093
  7. Avatar for Hellcat6 87. Hellcat6 Lv 1 2 pts. 11,080
  8. Avatar for Simek 88. Simek Lv 1 2 pts. 11,058
  9. Avatar for johnpwykes 89. johnpwykes Lv 1 2 pts. 11,054
  10. Avatar for dahast.de 90. dahast.de Lv 1 2 pts. 11,047

Comments