Placeholder image of a protein
Icon representing a puzzle

1993: Revisiting Puzzle 64: Thioredoxin

Closed since almost 5 years ago

Novice Overall Prediction

Summary

Created
May 13, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,805
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 11,794
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 11,783
  4. Avatar for Marvin's bunch 4. Marvin's bunch 38 pts. 11,702
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 11,692
  6. Avatar for Contenders 6. Contenders 18 pts. 11,626
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 11,602
  8. Avatar for Void Crushers 8. Void Crushers 8 pts. 11,536
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 5 pts. 11,442
  10. Avatar for Czech National Team 10. Czech National Team 3 pts. 11,400
  1. Avatar for NeedMoreCoffee 31. NeedMoreCoffee Lv 1 35 pts. 11,548
  2. Avatar for spdenne 32. spdenne Lv 1 34 pts. 11,536
  3. Avatar for NeLikomSheet 33. NeLikomSheet Lv 1 33 pts. 11,516
  4. Avatar for OWM3 34. OWM3 Lv 1 31 pts. 11,512
  5. Avatar for Anfinsen_slept_here 35. Anfinsen_slept_here Lv 1 30 pts. 11,505
  6. Avatar for frostschutz 36. frostschutz Lv 1 29 pts. 11,499
  7. Avatar for ZeroLeak7 37. ZeroLeak7 Lv 1 28 pts. 11,496
  8. Avatar for maithra 38. maithra Lv 1 27 pts. 11,491
  9. Avatar for PigeonBar 39. PigeonBar Lv 1 26 pts. 11,491
  10. Avatar for borattt 40. borattt Lv 1 25 pts. 11,478

Comments