Placeholder image of a protein
Icon representing a puzzle

2004: Revisiting Puzzle 67: Integrase

Closed since almost 5 years ago

Novice Overall Prediction

Summary


Created
June 10, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 3 pts. 9,969
  2. Avatar for Void Crushers 12. Void Crushers 2 pts. 9,966
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 9,622
  4. Avatar for Australia 14. Australia 1 pt. 9,542
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 9,512
  6. Avatar for Team China 16. Team China 1 pt. 9,501
  7. Avatar for Window Group 17. Window Group 1 pt. 3,439
  8. Avatar for incognito group 19. incognito group 1 pt. 2,966
  9. Avatar for Foldit Staff 20. Foldit Staff 1 pt. 2,966

  1. Avatar for toshiue 41. toshiue Lv 1 19 pts. 10,131
  2. Avatar for Todd6485577 42. Todd6485577 Lv 1 18 pts. 10,123
  3. Avatar for ucad 43. ucad Lv 1 18 pts. 10,121
  4. Avatar for Blipperman 44. Blipperman Lv 1 17 pts. 10,120
  5. Avatar for maithra 45. maithra Lv 1 16 pts. 10,109
  6. Avatar for Keresto 46. Keresto Lv 1 15 pts. 10,099
  7. Avatar for jsfoldingaccount 47. jsfoldingaccount Lv 1 14 pts. 10,098
  8. Avatar for akaaka 48. akaaka Lv 1 14 pts. 10,094
  9. Avatar for rezaefar 49. rezaefar Lv 1 13 pts. 10,083
  10. Avatar for BerkayGunay 50. BerkayGunay Lv 1 12 pts. 10,078

Comments