Placeholder image of a protein
Icon representing a puzzle

2004: Revisiting Puzzle 67: Integrase

Closed since almost 5 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
June 10, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 3 pts. 9,969
  2. Avatar for Void Crushers 12. Void Crushers 2 pts. 9,966
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 9,622
  4. Avatar for Australia 14. Australia 1 pt. 9,542
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 9,512
  6. Avatar for Team China 16. Team China 1 pt. 9,501
  7. Avatar for Window Group 17. Window Group 1 pt. 3,439
  8. Avatar for incognito group 19. incognito group 1 pt. 2,966
  9. Avatar for Foldit Staff 20. Foldit Staff 1 pt. 2,966

  1. Avatar for Maerlyn138 81. Maerlyn138 Lv 1 2 pts. 9,782
  2. Avatar for huetran 82. huetran Lv 1 2 pts. 9,775
  3. Avatar for luxin66 83. luxin66 Lv 1 2 pts. 9,759
  4. Avatar for Trajan464 84. Trajan464 Lv 1 2 pts. 9,720
  5. Avatar for Beany 85. Beany Lv 1 2 pts. 9,720
  6. Avatar for cjddig 86. cjddig Lv 1 1 pt. 9,709
  7. Avatar for bamh 87. bamh Lv 1 1 pt. 9,698
  8. Avatar for BarrySampson 88. BarrySampson Lv 1 1 pt. 9,689
  9. Avatar for DScott 89. DScott Lv 1 1 pt. 9,683
  10. Avatar for Evica 90. Evica Lv 1 1 pt. 9,646

Comments