Placeholder image of a protein
Icon representing a puzzle

2010: Revisiting Puzzle 68: Bos Taurus

Closed since almost 5 years ago

Novice Overall Prediction

Summary

Created
June 24, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups

  1. Avatar for METU-BIN 11. METU-BIN 1 pt. 10,094
  2. Avatar for Czech National Team 12. Czech National Team 1 pt. 9,878
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 9,587
  4. Avatar for Texas Tech Red Folders 14. Texas Tech Red Folders 1 pt. 8,822
  5. Avatar for Window Group 15. Window Group 1 pt. 6,417
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 4,858
  1. Avatar for CAN1958 111. CAN1958 Lv 1 1 pt. 9,054
  2. Avatar for sgaray 112. sgaray Lv 1 1 pt. 8,938
  3. Avatar for Sarah Coppens 113. Sarah Coppens Lv 1 1 pt. 8,856
  4. Avatar for Clunkydunky 114. Clunkydunky Lv 1 1 pt. 8,839
  5. Avatar for krosika1 115. krosika1 Lv 1 1 pt. 8,822
  6. Avatar for kyber4353 116. kyber4353 Lv 1 1 pt. 8,818
  7. Avatar for incognito genie 117. incognito genie Lv 1 1 pt. 8,158
  8. Avatar for kingakubatata 118. kingakubatata Lv 1 1 pt. 8,143
  9. Avatar for Rutecasso 119. Rutecasso Lv 1 1 pt. 8,130
  10. Avatar for Reactive 120. Reactive Lv 1 1 pt. 7,219

Comments