Placeholder image of a protein
Icon representing a puzzle

2010: Revisiting Puzzle 68: Bos Taurus

Closed since almost 5 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
June 24, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups


  1. Avatar for METU-BIN 11. METU-BIN 1 pt. 10,094
  2. Avatar for Czech National Team 12. Czech National Team 1 pt. 9,878
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 9,587
  4. Avatar for Texas Tech Red Folders 14. Texas Tech Red Folders 1 pt. 8,822
  5. Avatar for Window Group 15. Window Group 1 pt. 6,417
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 4,858

  1. Avatar for alcor29 11. alcor29 Lv 1 68 pts. 10,586
  2. Avatar for MicElephant 12. MicElephant Lv 1 65 pts. 10,584
  3. Avatar for Deleted player 13. Deleted player pts. 10,575
  4. Avatar for jausmh 14. jausmh Lv 1 60 pts. 10,566
  5. Avatar for mirp 15. mirp Lv 1 58 pts. 10,564
  6. Avatar for Skippysk8s 16. Skippysk8s Lv 1 55 pts. 10,564
  7. Avatar for jobo0502 17. jobo0502 Lv 1 53 pts. 10,559
  8. Avatar for grogar7 18. grogar7 Lv 1 51 pts. 10,558
  9. Avatar for ichwilldiesennamen 19. ichwilldiesennamen Lv 1 49 pts. 10,553
  10. Avatar for Phyx 20. Phyx Lv 1 46 pts. 10,544

Comments