Placeholder image of a protein
Icon representing a puzzle

2010: Revisiting Puzzle 68: Bos Taurus

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
June 24, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,737
  2. Avatar for Beta Folders 2. Beta Folders 71 pts. 10,717
  3. Avatar for Contenders 3. Contenders 49 pts. 10,706
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 33 pts. 10,621
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 22 pts. 10,610
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 10,573
  7. Avatar for Gargleblasters 7. Gargleblasters 8 pts. 10,564
  8. Avatar for Void Crushers 8. Void Crushers 5 pts. 10,449
  9. Avatar for HMT heritage 9. HMT heritage 3 pts. 10,432
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 10,307
  1. Avatar for alcor29 11. alcor29 Lv 1 68 pts. 10,586
  2. Avatar for MicElephant 12. MicElephant Lv 1 65 pts. 10,584
  3. Avatar for Deleted player 13. Deleted player pts. 10,575
  4. Avatar for jausmh 14. jausmh Lv 1 60 pts. 10,566
  5. Avatar for mirp 15. mirp Lv 1 58 pts. 10,564
  6. Avatar for Skippysk8s 16. Skippysk8s Lv 1 55 pts. 10,564
  7. Avatar for jobo0502 17. jobo0502 Lv 1 53 pts. 10,559
  8. Avatar for grogar7 18. grogar7 Lv 1 51 pts. 10,558
  9. Avatar for ichwilldiesennamen 19. ichwilldiesennamen Lv 1 49 pts. 10,553
  10. Avatar for Phyx 20. Phyx Lv 1 46 pts. 10,544

Comments