Placeholder image of a protein
Icon representing a puzzle

2010: Revisiting Puzzle 68: Bos Taurus

Closed since almost 5 years ago

Novice Overall Prediction

Summary


Created
June 24, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups


  1. Avatar for METU-BIN 11. METU-BIN 1 pt. 10,094
  2. Avatar for Czech National Team 12. Czech National Team 1 pt. 9,878
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 9,587
  4. Avatar for Texas Tech Red Folders 14. Texas Tech Red Folders 1 pt. 8,822
  5. Avatar for Window Group 15. Window Group 1 pt. 6,417
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 4,858

  1. Avatar for Visok 41. Visok Lv 1 17 pts. 10,302
  2. Avatar for bamh 42. bamh Lv 1 16 pts. 10,299
  3. Avatar for NeLikomSheet 43. NeLikomSheet Lv 1 15 pts. 10,289
  4. Avatar for Maerlyn138 44. Maerlyn138 Lv 1 14 pts. 10,285
  5. Avatar for Deleted player 45. Deleted player 14 pts. 10,278
  6. Avatar for NinjaGreg 46. NinjaGreg Lv 1 13 pts. 10,264
  7. Avatar for BarrySampson 47. BarrySampson Lv 1 12 pts. 10,258
  8. Avatar for zippyc137 48. zippyc137 Lv 1 12 pts. 10,250
  9. Avatar for toshiue 49. toshiue Lv 1 11 pts. 10,238
  10. Avatar for MirsadaH 50. MirsadaH Lv 1 10 pts. 10,215

Comments