Placeholder image of a protein
Icon representing a puzzle

2010: Revisiting Puzzle 68: Bos Taurus

Closed since almost 5 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
June 24, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups


  1. Avatar for Go Science 100 pts. 10,737
  2. Avatar for Beta Folders 2. Beta Folders 71 pts. 10,717
  3. Avatar for Contenders 3. Contenders 49 pts. 10,706
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 33 pts. 10,621
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 22 pts. 10,610
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 10,573
  7. Avatar for Gargleblasters 7. Gargleblasters 8 pts. 10,564
  8. Avatar for Void Crushers 8. Void Crushers 5 pts. 10,449
  9. Avatar for HMT heritage 9. HMT heritage 3 pts. 10,432
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 10,307

  1. Avatar for Visok 41. Visok Lv 1 17 pts. 10,302
  2. Avatar for bamh 42. bamh Lv 1 16 pts. 10,299
  3. Avatar for NeLikomSheet 43. NeLikomSheet Lv 1 15 pts. 10,289
  4. Avatar for Maerlyn138 44. Maerlyn138 Lv 1 14 pts. 10,285
  5. Avatar for Deleted player 45. Deleted player 14 pts. 10,278
  6. Avatar for NinjaGreg 46. NinjaGreg Lv 1 13 pts. 10,264
  7. Avatar for BarrySampson 47. BarrySampson Lv 1 12 pts. 10,258
  8. Avatar for zippyc137 48. zippyc137 Lv 1 12 pts. 10,250
  9. Avatar for toshiue 49. toshiue Lv 1 11 pts. 10,238
  10. Avatar for MirsadaH 50. MirsadaH Lv 1 10 pts. 10,215

Comments