Placeholder image of a protein
Icon representing a puzzle

2010: Revisiting Puzzle 68: Bos Taurus

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
June 24, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,737
  2. Avatar for Beta Folders 2. Beta Folders 71 pts. 10,717
  3. Avatar for Contenders 3. Contenders 49 pts. 10,706
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 33 pts. 10,621
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 22 pts. 10,610
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 10,573
  7. Avatar for Gargleblasters 7. Gargleblasters 8 pts. 10,564
  8. Avatar for Void Crushers 8. Void Crushers 5 pts. 10,449
  9. Avatar for HMT heritage 9. HMT heritage 3 pts. 10,432
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 10,307
  1. Avatar for BootsMcGraw 21. BootsMcGraw Lv 1 44 pts. 10,544
  2. Avatar for borattt 22. borattt Lv 1 43 pts. 10,517
  3. Avatar for sallallami 23. sallallami Lv 1 41 pts. 10,509
  4. Avatar for Galaxie 24. Galaxie Lv 1 39 pts. 10,481
  5. Avatar for manu8170 25. manu8170 Lv 1 37 pts. 10,479
  6. Avatar for frood66 26. frood66 Lv 1 35 pts. 10,478
  7. Avatar for stomjoh 27. stomjoh Lv 1 34 pts. 10,475
  8. Avatar for maithra 28. maithra Lv 1 32 pts. 10,475
  9. Avatar for nicobul 29. nicobul Lv 1 31 pts. 10,455
  10. Avatar for Simek 30. Simek Lv 1 29 pts. 10,449

Comments