Placeholder image of a protein
Icon representing a puzzle

2016: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
July 08, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 10,021
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 9,922
  3. Avatar for SARE/BRBT 2021 13. SARE/BRBT 2021 1 pt. 9,592
  4. Avatar for test_group1 14. test_group1 1 pt. 3,796
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 3,796
  1. Avatar for DScott 101. DScott Lv 1 1 pt. 9,668
  2. Avatar for furi0us 102. furi0us Lv 1 1 pt. 9,626
  3. Avatar for AZ-BRBT21 103. AZ-BRBT21 Lv 1 1 pt. 9,592
  4. Avatar for wuhanese 104. wuhanese Lv 1 1 pt. 9,591
  5. Avatar for deathbat_87 105. deathbat_87 Lv 1 1 pt. 9,566
  6. Avatar for Dagal 106. Dagal Lv 1 1 pt. 9,561
  7. Avatar for Giantbluefish 107. Giantbluefish Lv 1 1 pt. 9,556
  8. Avatar for ivalnic 108. ivalnic Lv 1 1 pt. 9,546
  9. Avatar for ToyRoBoHoBo 109. ToyRoBoHoBo Lv 1 1 pt. 9,537
  10. Avatar for DH5alpha 110. DH5alpha Lv 1 1 pt. 9,537

Comments