Placeholder image of a protein
Icon representing a puzzle

2016: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
July 08, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,957
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 10,950
  3. Avatar for Go Science 3. Go Science 47 pts. 10,945
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 10,724
  5. Avatar for Marvin's bunch 5. Marvin's bunch 19 pts. 10,715
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 10,601
  7. Avatar for Void Crushers 7. Void Crushers 7 pts. 10,520
  8. Avatar for Contenders 8. Contenders 4 pts. 10,419
  9. Avatar for Australia 9. Australia 2 pts. 10,325
  10. Avatar for Team China 10. Team China 1 pt. 10,176
  1. Avatar for DScott 101. DScott Lv 1 1 pt. 9,668
  2. Avatar for furi0us 102. furi0us Lv 1 1 pt. 9,626
  3. Avatar for AZ-BRBT21 103. AZ-BRBT21 Lv 1 1 pt. 9,592
  4. Avatar for wuhanese 104. wuhanese Lv 1 1 pt. 9,591
  5. Avatar for deathbat_87 105. deathbat_87 Lv 1 1 pt. 9,566
  6. Avatar for Dagal 106. Dagal Lv 1 1 pt. 9,561
  7. Avatar for Giantbluefish 107. Giantbluefish Lv 1 1 pt. 9,556
  8. Avatar for ivalnic 108. ivalnic Lv 1 1 pt. 9,546
  9. Avatar for ToyRoBoHoBo 109. ToyRoBoHoBo Lv 1 1 pt. 9,537
  10. Avatar for DH5alpha 110. DH5alpha Lv 1 1 pt. 9,537

Comments