Placeholder image of a protein
Icon representing a puzzle

2016: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 4 years ago

Novice Novice Overall Overall Prediction Prediction

Summary

Created
July 08, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 10,021
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 9,922
  3. Avatar for SARE/BRBT 2021 13. SARE/BRBT 2021 1 pt. 9,592
  4. Avatar for test_group1 14. test_group1 1 pt. 3,796
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 3,796
  1. Avatar for lwan9310 111. lwan9310 Lv 1 1 pt. 9,497
  2. Avatar for lickington 112. lickington Lv 1 1 pt. 9,467
  3. Avatar for mwm64 113. mwm64 Lv 1 1 pt. 9,358
  4. Avatar for krass 114. krass Lv 1 1 pt. 9,188
  5. Avatar for patriciaschaker 115. patriciaschaker Lv 1 1 pt. 7,408
  6. Avatar for 01010011111 116. 01010011111 Lv 1 1 pt. 6,211
  7. Avatar for army0613 117. army0613 Lv 1 1 pt. 5,336
  8. Avatar for harvardman 118. harvardman Lv 1 1 pt. 5,048
  9. Avatar for micaeloliveira 119. micaeloliveira Lv 1 1 pt. 3,848
  10. Avatar for Sergio2806 120. Sergio2806 Lv 1 1 pt. 3,847

Comments