Placeholder image of a protein
Icon representing a puzzle

2016: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
July 08, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,957
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 10,950
  3. Avatar for Go Science 3. Go Science 47 pts. 10,945
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 10,724
  5. Avatar for Marvin's bunch 5. Marvin's bunch 19 pts. 10,715
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 10,601
  7. Avatar for Void Crushers 7. Void Crushers 7 pts. 10,520
  8. Avatar for Contenders 8. Contenders 4 pts. 10,419
  9. Avatar for Australia 9. Australia 2 pts. 10,325
  10. Avatar for Team China 10. Team China 1 pt. 10,176
  1. Avatar for lwan9310 111. lwan9310 Lv 1 1 pt. 9,497
  2. Avatar for lickington 112. lickington Lv 1 1 pt. 9,467
  3. Avatar for mwm64 113. mwm64 Lv 1 1 pt. 9,358
  4. Avatar for krass 114. krass Lv 1 1 pt. 9,188
  5. Avatar for patriciaschaker 115. patriciaschaker Lv 1 1 pt. 7,408
  6. Avatar for 01010011111 116. 01010011111 Lv 1 1 pt. 6,211
  7. Avatar for army0613 117. army0613 Lv 1 1 pt. 5,336
  8. Avatar for harvardman 118. harvardman Lv 1 1 pt. 5,048
  9. Avatar for micaeloliveira 119. micaeloliveira Lv 1 1 pt. 3,848
  10. Avatar for Sergio2806 120. Sergio2806 Lv 1 1 pt. 3,847

Comments