Placeholder image of a protein
Icon representing a puzzle

2016: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
July 08, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,957
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 10,950
  3. Avatar for Go Science 3. Go Science 47 pts. 10,945
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 10,724
  5. Avatar for Marvin's bunch 5. Marvin's bunch 19 pts. 10,715
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 10,601
  7. Avatar for Void Crushers 7. Void Crushers 7 pts. 10,520
  8. Avatar for Contenders 8. Contenders 4 pts. 10,419
  9. Avatar for Australia 9. Australia 2 pts. 10,325
  10. Avatar for Team China 10. Team China 1 pt. 10,176
  1. Avatar for test_account1 121. test_account1 Lv 1 1 pt. 3,796
  2. Avatar for bkoep 122. bkoep Lv 1 1 pt. 3,796
  3. Avatar for taehyeon KOR 123. taehyeon KOR Lv 1 1 pt. 3,796
  4. Avatar for mateo111 124. mateo111 Lv 1 1 pt. 3,796
  5. Avatar for Keresto 125. Keresto Lv 1 1 pt. 3,796
  6. Avatar for Bletchley Park 126. Bletchley Park Lv 1 1 pt. 3,796
  7. Avatar for pyc0208 127. pyc0208 Lv 1 1 pt. 3,796
  8. Avatar for rmoretti 128. rmoretti Lv 1 1 pt. 3,796
  9. Avatar for spvincent 129. spvincent Lv 1 1 pt. 3,796

Comments