Placeholder image of a protein
Icon representing a puzzle

2028: Revisiting Puzzle 74: Platypus Venom

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
August 05, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom-a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,770
  2. Avatar for Marvin's bunch 2. Marvin's bunch 71 pts. 9,736
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 49 pts. 9,727
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 9,717
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 9,605
  6. Avatar for Russian team 6. Russian team 14 pts. 9,479
  7. Avatar for Contenders 7. Contenders 8 pts. 9,391
  8. Avatar for Australia 8. Australia 5 pts. 9,186
  9. Avatar for BOINC@Poland 9. BOINC@Poland 3 pts. 9,068
  10. Avatar for Gargleblasters 10. Gargleblasters 2 pts. 9,021
  1. Avatar for melodyt 131. melodyt Lv 1 1 pt. 7,671
  2. Avatar for Rubio_46315306 132. Rubio_46315306 Lv 1 1 pt. 7,664
  3. Avatar for boboviz 133. boboviz Lv 1 1 pt. 7,628
  4. Avatar for joshtest01 134. joshtest01 Lv 1 1 pt. 7,393
  5. Avatar for hello orange 135. hello orange Lv 1 1 pt. 7,359
  6. Avatar for zippyc137 136. zippyc137 Lv 1 1 pt. 7,311
  7. Avatar for a7lien 137. a7lien Lv 1 1 pt. 7,212
  8. Avatar for marko1616 138. marko1616 Lv 1 1 pt. 7,210
  9. Avatar for jflat06 139. jflat06 Lv 1 1 pt. 7,076
  10. Avatar for Gabriel Ortega 140. Gabriel Ortega Lv 1 1 pt. 6,076

Comments