Placeholder image of a protein
Icon representing a puzzle

2028: Revisiting Puzzle 74: Platypus Venom

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
August 05, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom-a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,770
  2. Avatar for Marvin's bunch 2. Marvin's bunch 71 pts. 9,736
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 49 pts. 9,727
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 9,717
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 9,605
  6. Avatar for Russian team 6. Russian team 14 pts. 9,479
  7. Avatar for Contenders 7. Contenders 8 pts. 9,391
  8. Avatar for Australia 8. Australia 5 pts. 9,186
  9. Avatar for BOINC@Poland 9. BOINC@Poland 3 pts. 9,068
  10. Avatar for Gargleblasters 10. Gargleblasters 2 pts. 9,021
  1. Avatar for NailzYulaw 121. NailzYulaw Lv 1 1 pt. 7,861
  2. Avatar for Swapper242 122. Swapper242 Lv 1 1 pt. 7,794
  3. Avatar for minekham 123. minekham Lv 1 1 pt. 7,790
  4. Avatar for harvardman 124. harvardman Lv 1 1 pt. 7,788
  5. Avatar for furi0us 125. furi0us Lv 1 1 pt. 7,786
  6. Avatar for yuemin ma 126. yuemin ma Lv 1 1 pt. 7,779
  7. Avatar for dm1111 127. dm1111 Lv 1 1 pt. 7,758
  8. Avatar for RafaMac 128. RafaMac Lv 1 1 pt. 7,730
  9. Avatar for Pyxicephalus 129. Pyxicephalus Lv 1 1 pt. 7,707
  10. Avatar for mkiederer@aol.com 130. mkiederer@aol.com Lv 1 1 pt. 7,681

Comments