Placeholder image of a protein
Icon representing a puzzle

2028: Revisiting Puzzle 74: Platypus Venom

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
August 05, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom-a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,770
  2. Avatar for Marvin's bunch 2. Marvin's bunch 71 pts. 9,736
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 49 pts. 9,727
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 9,717
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 9,605
  6. Avatar for Russian team 6. Russian team 14 pts. 9,479
  7. Avatar for Contenders 7. Contenders 8 pts. 9,391
  8. Avatar for Australia 8. Australia 5 pts. 9,186
  9. Avatar for BOINC@Poland 9. BOINC@Poland 3 pts. 9,068
  10. Avatar for Gargleblasters 10. Gargleblasters 2 pts. 9,021
  1. Avatar for brucederby 111. brucederby Lv 1 1 pt. 8,110
  2. Avatar for davidandersoniii 112. davidandersoniii Lv 1 1 pt. 8,087
  3. Avatar for Beany 113. Beany Lv 1 1 pt. 8,071
  4. Avatar for Giparang 114. Giparang Lv 1 1 pt. 7,984
  5. Avatar for kyoota 115. kyoota Lv 1 1 pt. 7,980
  6. Avatar for OWM3 116. OWM3 Lv 1 1 pt. 7,943
  7. Avatar for ziyu zhou 117. ziyu zhou Lv 1 1 pt. 7,943
  8. Avatar for andresesuarezj 118. andresesuarezj Lv 1 1 pt. 7,932
  9. Avatar for Cicadashell 119. Cicadashell Lv 1 1 pt. 7,911
  10. Avatar for spagheeetti 120. spagheeetti Lv 1 1 pt. 7,879

Comments