Placeholder image of a protein
Icon representing a puzzle

2028: Revisiting Puzzle 74: Platypus Venom

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
August 05, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom-a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,770
  2. Avatar for Marvin's bunch 2. Marvin's bunch 71 pts. 9,736
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 49 pts. 9,727
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 9,717
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 9,605
  6. Avatar for Russian team 6. Russian team 14 pts. 9,479
  7. Avatar for Contenders 7. Contenders 8 pts. 9,391
  8. Avatar for Australia 8. Australia 5 pts. 9,186
  9. Avatar for BOINC@Poland 9. BOINC@Poland 3 pts. 9,068
  10. Avatar for Gargleblasters 10. Gargleblasters 2 pts. 9,021
  1. Avatar for Dr.Sillem 81. Dr.Sillem Lv 1 3 pts. 8,471
  2. Avatar for frostschutz 82. frostschutz Lv 1 2 pts. 8,455
  3. Avatar for Trajan464 83. Trajan464 Lv 1 2 pts. 8,445
  4. Avatar for reich64 84. reich64 Lv 1 2 pts. 8,419
  5. Avatar for argyrw 85. argyrw Lv 1 2 pts. 8,417
  6. Avatar for Larini 86. Larini Lv 1 2 pts. 8,413
  7. Avatar for kitsoune 87. kitsoune Lv 1 2 pts. 8,386
  8. Avatar for Todd6485577 88. Todd6485577 Lv 1 2 pts. 8,366
  9. Avatar for Yang98 89. Yang98 Lv 1 2 pts. 8,365
  10. Avatar for rinze 90. rinze Lv 1 2 pts. 8,350

Comments