Placeholder image of a protein
Icon representing a puzzle

2030: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
August 12, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 9,596
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 9,559
  3. Avatar for Learn When To Fold It 13. Learn When To Fold It 1 pt. 9,224
  4. Avatar for test_group1 14. test_group1 1 pt. 0
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 0
  6. Avatar for test 2 16. test 2 1 pt. 0
  7. Avatar for Window Group 17. Window Group 1 pt. 0
  1. Avatar for argyrw 91. argyrw Lv 1 1 pt. 9,506
  2. Avatar for Beany 92. Beany Lv 1 1 pt. 9,490
  3. Avatar for Bucsan 93. Bucsan Lv 1 1 pt. 9,482
  4. Avatar for DScott 94. DScott Lv 1 1 pt. 9,478
  5. Avatar for pfirth 95. pfirth Lv 1 1 pt. 9,471
  6. Avatar for Dr.Sillem 96. Dr.Sillem Lv 1 1 pt. 9,459
  7. Avatar for Todd6485577 97. Todd6485577 Lv 1 1 pt. 9,459
  8. Avatar for Visok 98. Visok Lv 1 1 pt. 9,453
  9. Avatar for aendgraend 99. aendgraend Lv 1 1 pt. 9,415
  10. Avatar for rinze 100. rinze Lv 1 1 pt. 9,412

Comments