Placeholder image of a protein
Icon representing a puzzle

2030: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
August 12, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,195
  2. Avatar for Go Science 2. Go Science 73 pts. 10,174
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 10,153
  4. Avatar for Contenders 4. Contenders 36 pts. 10,135
  5. Avatar for Marvin's bunch 5. Marvin's bunch 24 pts. 10,076
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 10,069
  7. Avatar for Gargleblasters 7. Gargleblasters 10 pts. 9,971
  8. Avatar for Russian team 8. Russian team 6 pts. 9,906
  9. Avatar for Australia 9. Australia 4 pts. 9,866
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 9,701
  1. Avatar for argyrw 91. argyrw Lv 1 1 pt. 9,506
  2. Avatar for Beany 92. Beany Lv 1 1 pt. 9,490
  3. Avatar for Bucsan 93. Bucsan Lv 1 1 pt. 9,482
  4. Avatar for DScott 94. DScott Lv 1 1 pt. 9,478
  5. Avatar for pfirth 95. pfirth Lv 1 1 pt. 9,471
  6. Avatar for Dr.Sillem 96. Dr.Sillem Lv 1 1 pt. 9,459
  7. Avatar for Todd6485577 97. Todd6485577 Lv 1 1 pt. 9,459
  8. Avatar for Visok 98. Visok Lv 1 1 pt. 9,453
  9. Avatar for aendgraend 99. aendgraend Lv 1 1 pt. 9,415
  10. Avatar for rinze 100. rinze Lv 1 1 pt. 9,412

Comments