Placeholder image of a protein
Icon representing a puzzle

2030: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
August 12, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 9,596
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 9,559
  3. Avatar for Learn When To Fold It 13. Learn When To Fold It 1 pt. 9,224
  4. Avatar for test_group1 14. test_group1 1 pt. 0
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 0
  6. Avatar for test 2 16. test 2 1 pt. 0
  7. Avatar for Window Group 17. Window Group 1 pt. 0
  1. Avatar for Deleted player 21. Deleted player pts. 10,042
  2. Avatar for johnmitch 22. johnmitch Lv 1 46 pts. 10,042
  3. Avatar for frood66 23. frood66 Lv 1 44 pts. 10,041
  4. Avatar for christioanchauvin 24. christioanchauvin Lv 1 42 pts. 10,034
  5. Avatar for maithra 25. maithra Lv 1 41 pts. 10,030
  6. Avatar for NinjaGreg 26. NinjaGreg Lv 1 39 pts. 10,026
  7. Avatar for akaaka 27. akaaka Lv 1 37 pts. 10,024
  8. Avatar for NPrincipi 28. NPrincipi Lv 1 36 pts. 10,012
  9. Avatar for phi16 29. phi16 Lv 1 34 pts. 10,006
  10. Avatar for Crossed Sticks 30. Crossed Sticks Lv 1 33 pts. 10,006

Comments