Placeholder image of a protein
Icon representing a puzzle

2030: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary


Created
August 12, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,195
  2. Avatar for Go Science 2. Go Science 73 pts. 10,174
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 10,153
  4. Avatar for Contenders 4. Contenders 36 pts. 10,135
  5. Avatar for Marvin's bunch 5. Marvin's bunch 24 pts. 10,076
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 10,069
  7. Avatar for Gargleblasters 7. Gargleblasters 10 pts. 9,971
  8. Avatar for Russian team 8. Russian team 6 pts. 9,906
  9. Avatar for Australia 9. Australia 4 pts. 9,866
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 9,701

  1. Avatar for Deleted player 21. Deleted player pts. 10,042
  2. Avatar for johnmitch 22. johnmitch Lv 1 46 pts. 10,042
  3. Avatar for frood66 23. frood66 Lv 1 44 pts. 10,041
  4. Avatar for christioanchauvin 24. christioanchauvin Lv 1 42 pts. 10,034
  5. Avatar for maithra 25. maithra Lv 1 41 pts. 10,030
  6. Avatar for NinjaGreg 26. NinjaGreg Lv 1 39 pts. 10,026
  7. Avatar for akaaka 27. akaaka Lv 1 37 pts. 10,024
  8. Avatar for NPrincipi 28. NPrincipi Lv 1 36 pts. 10,012
  9. Avatar for phi16 29. phi16 Lv 1 34 pts. 10,006
  10. Avatar for Crossed Sticks 30. Crossed Sticks Lv 1 33 pts. 10,006

Comments