Placeholder image of a protein
Icon representing a puzzle

2030: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
August 12, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 9,596
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 9,559
  3. Avatar for Learn When To Fold It 13. Learn When To Fold It 1 pt. 9,224
  4. Avatar for test_group1 14. test_group1 1 pt. 0
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 0
  6. Avatar for test 2 16. test 2 1 pt. 0
  7. Avatar for Window Group 17. Window Group 1 pt. 0
  1. Avatar for silent gene 41. silent gene Lv 1 20 pts. 9,967
  2. Avatar for andrewxc 42. andrewxc Lv 1 19 pts. 9,960
  3. Avatar for PeterDav 43. PeterDav Lv 1 18 pts. 9,953
  4. Avatar for ProfVince 44. ProfVince Lv 1 17 pts. 9,941
  5. Avatar for Deleted player 45. Deleted player 17 pts. 9,935
  6. Avatar for Deleted player 46. Deleted player 16 pts. 9,914
  7. Avatar for fiendish_ghoul 47. fiendish_ghoul Lv 1 15 pts. 9,911
  8. Avatar for Gerom 48. Gerom Lv 1 14 pts. 9,906
  9. Avatar for tracybutt 49. tracybutt Lv 1 14 pts. 9,900
  10. Avatar for katling 50. katling Lv 1 13 pts. 9,887

Comments