Placeholder image of a protein
Icon representing a puzzle

2030: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
August 12, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,195
  2. Avatar for Go Science 2. Go Science 73 pts. 10,174
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 10,153
  4. Avatar for Contenders 4. Contenders 36 pts. 10,135
  5. Avatar for Marvin's bunch 5. Marvin's bunch 24 pts. 10,076
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 10,069
  7. Avatar for Gargleblasters 7. Gargleblasters 10 pts. 9,971
  8. Avatar for Russian team 8. Russian team 6 pts. 9,906
  9. Avatar for Australia 9. Australia 4 pts. 9,866
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 9,701
  1. Avatar for silent gene 41. silent gene Lv 1 20 pts. 9,967
  2. Avatar for andrewxc 42. andrewxc Lv 1 19 pts. 9,960
  3. Avatar for PeterDav 43. PeterDav Lv 1 18 pts. 9,953
  4. Avatar for ProfVince 44. ProfVince Lv 1 17 pts. 9,941
  5. Avatar for Deleted player 45. Deleted player 17 pts. 9,935
  6. Avatar for Deleted player 46. Deleted player 16 pts. 9,914
  7. Avatar for fiendish_ghoul 47. fiendish_ghoul Lv 1 15 pts. 9,911
  8. Avatar for Gerom 48. Gerom Lv 1 14 pts. 9,906
  9. Avatar for tracybutt 49. tracybutt Lv 1 14 pts. 9,900
  10. Avatar for katling 50. katling Lv 1 13 pts. 9,887

Comments