Placeholder image of a protein
Icon representing a puzzle

2030: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
August 12, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 9,596
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 9,559
  3. Avatar for Learn When To Fold It 13. Learn When To Fold It 1 pt. 9,224
  4. Avatar for test_group1 14. test_group1 1 pt. 0
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 0
  6. Avatar for test 2 16. test 2 1 pt. 0
  7. Avatar for Window Group 17. Window Group 1 pt. 0
  1. Avatar for Bruno Kestemont 51. Bruno Kestemont Lv 1 12 pts. 9,885
  2. Avatar for blazegeek 52. blazegeek Lv 1 12 pts. 9,881
  3. Avatar for kentish_alex 53. kentish_alex Lv 1 11 pts. 9,872
  4. Avatar for NeLikomSheet 54. NeLikomSheet Lv 1 11 pts. 9,869
  5. Avatar for Wiz kid 55. Wiz kid Lv 1 10 pts. 9,866
  6. Avatar for Zosa 56. Zosa Lv 1 10 pts. 9,857
  7. Avatar for borattt 57. borattt Lv 1 9 pts. 9,839
  8. Avatar for kyoota 58. kyoota Lv 1 9 pts. 9,812
  9. Avatar for zippyc137 59. zippyc137 Lv 1 8 pts. 9,805
  10. Avatar for BootsMcGraw 60. BootsMcGraw Lv 1 8 pts. 9,801

Comments