Placeholder image of a protein
Icon representing a puzzle

2030: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
August 12, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,195
  2. Avatar for Go Science 2. Go Science 73 pts. 10,174
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 10,153
  4. Avatar for Contenders 4. Contenders 36 pts. 10,135
  5. Avatar for Marvin's bunch 5. Marvin's bunch 24 pts. 10,076
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 10,069
  7. Avatar for Gargleblasters 7. Gargleblasters 10 pts. 9,971
  8. Avatar for Russian team 8. Russian team 6 pts. 9,906
  9. Avatar for Australia 9. Australia 4 pts. 9,866
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 9,701
  1. Avatar for Bruno Kestemont 51. Bruno Kestemont Lv 1 12 pts. 9,885
  2. Avatar for blazegeek 52. blazegeek Lv 1 12 pts. 9,881
  3. Avatar for kentish_alex 53. kentish_alex Lv 1 11 pts. 9,872
  4. Avatar for NeLikomSheet 54. NeLikomSheet Lv 1 11 pts. 9,869
  5. Avatar for Wiz kid 55. Wiz kid Lv 1 10 pts. 9,866
  6. Avatar for Zosa 56. Zosa Lv 1 10 pts. 9,857
  7. Avatar for borattt 57. borattt Lv 1 9 pts. 9,839
  8. Avatar for kyoota 58. kyoota Lv 1 9 pts. 9,812
  9. Avatar for zippyc137 59. zippyc137 Lv 1 8 pts. 9,805
  10. Avatar for BootsMcGraw 60. BootsMcGraw Lv 1 8 pts. 9,801

Comments