Placeholder image of a protein
Icon representing a puzzle

2030: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
August 12, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 9,596
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 9,559
  3. Avatar for Learn When To Fold It 13. Learn When To Fold It 1 pt. 9,224
  4. Avatar for test_group1 14. test_group1 1 pt. 0
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 0
  6. Avatar for test 2 16. test 2 1 pt. 0
  7. Avatar for Window Group 17. Window Group 1 pt. 0
  1. Avatar for Alistair69 81. Alistair69 Lv 1 2 pts. 9,620
  2. Avatar for ManVsYard 82. ManVsYard Lv 1 2 pts. 9,598
  3. Avatar for MirsadaH 83. MirsadaH Lv 1 2 pts. 9,596
  4. Avatar for jawz101 84. jawz101 Lv 1 2 pts. 9,594
  5. Avatar for cjddig 85. cjddig Lv 1 2 pts. 9,594
  6. Avatar for Larini 86. Larini Lv 1 2 pts. 9,593
  7. Avatar for Keresto 87. Keresto Lv 1 2 pts. 9,566
  8. Avatar for AlkiP0Ps 88. AlkiP0Ps Lv 1 1 pt. 9,563
  9. Avatar for dahast.de 89. dahast.de Lv 1 1 pt. 9,559
  10. Avatar for fishercat 90. fishercat Lv 1 1 pt. 9,549

Comments