Placeholder image of a protein
Icon representing a puzzle

2030: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
August 12, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,195
  2. Avatar for Go Science 2. Go Science 73 pts. 10,174
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 10,153
  4. Avatar for Contenders 4. Contenders 36 pts. 10,135
  5. Avatar for Marvin's bunch 5. Marvin's bunch 24 pts. 10,076
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 10,069
  7. Avatar for Gargleblasters 7. Gargleblasters 10 pts. 9,971
  8. Avatar for Russian team 8. Russian team 6 pts. 9,906
  9. Avatar for Australia 9. Australia 4 pts. 9,866
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 9,701
  1. Avatar for Alistair69 81. Alistair69 Lv 1 2 pts. 9,620
  2. Avatar for ManVsYard 82. ManVsYard Lv 1 2 pts. 9,598
  3. Avatar for MirsadaH 83. MirsadaH Lv 1 2 pts. 9,596
  4. Avatar for jawz101 84. jawz101 Lv 1 2 pts. 9,594
  5. Avatar for cjddig 85. cjddig Lv 1 2 pts. 9,594
  6. Avatar for Larini 86. Larini Lv 1 2 pts. 9,593
  7. Avatar for Keresto 87. Keresto Lv 1 2 pts. 9,566
  8. Avatar for AlkiP0Ps 88. AlkiP0Ps Lv 1 1 pt. 9,563
  9. Avatar for dahast.de 89. dahast.de Lv 1 1 pt. 9,559
  10. Avatar for fishercat 90. fishercat Lv 1 1 pt. 9,549

Comments