Placeholder image of a protein
Icon representing a puzzle

2036: Revisiting Puzzle 77: Copper Chaperone

Closed since over 4 years ago

Novice Novice Overall Overall Prediction Prediction

Summary

Created
August 25, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,366
  2. Avatar for chem2523 assignment 12. chem2523 assignment 1 pt. 8,973
  3. Avatar for Russian team 13. Russian team 1 pt. 8,953
  4. Avatar for Team China 14. Team China 1 pt. 8,387
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 7,685
  6. Avatar for Window Group 16. Window Group 1 pt. 7,646
  7. Avatar for IBS BCS 17. IBS BCS 1 pt. 6,482
  1. Avatar for Zosa 91. Zosa Lv 1 3 pts. 9,238
  2. Avatar for MrZanav 92. MrZanav Lv 1 3 pts. 9,223
  3. Avatar for kevin everington 93. kevin everington Lv 1 3 pts. 9,216
  4. Avatar for frostschutz 94. frostschutz Lv 1 3 pts. 9,213
  5. Avatar for davidandersoniii 95. davidandersoniii Lv 1 3 pts. 9,192
  6. Avatar for Beany 96. Beany Lv 1 3 pts. 9,172
  7. Avatar for Arne Heessels 97. Arne Heessels Lv 1 3 pts. 9,165
  8. Avatar for abiogenesis 98. abiogenesis Lv 1 2 pts. 9,165
  9. Avatar for Dr.Sillem 99. Dr.Sillem Lv 1 2 pts. 9,160
  10. Avatar for pascal ochem 100. pascal ochem Lv 1 2 pts. 9,141

Comments