Placeholder image of a protein
Icon representing a puzzle

2036: Revisiting Puzzle 77: Copper Chaperone

Closed since over 4 years ago

Novice Overall Prediction

Summary


Created
August 25, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,366
  2. Avatar for chem2523 assignment 12. chem2523 assignment 1 pt. 8,973
  3. Avatar for Russian team 13. Russian team 1 pt. 8,953
  4. Avatar for Team China 14. Team China 1 pt. 8,387
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 7,685
  6. Avatar for Window Group 16. Window Group 1 pt. 7,646
  7. Avatar for IBS BCS 17. IBS BCS 1 pt. 6,482

  1. Avatar for borattt 101. borattt Lv 1 2 pts. 9,122
  2. Avatar for sophieluker 102. sophieluker Lv 1 2 pts. 9,088
  3. Avatar for Merf 103. Merf Lv 1 2 pts. 9,084
  4. Avatar for cjddig 104. cjddig Lv 1 2 pts. 9,083
  5. Avatar for Schulzie 105. Schulzie Lv 1 2 pts. 9,075
  6. Avatar for DScott 106. DScott Lv 1 2 pts. 9,048
  7. Avatar for mngu2184 107. mngu2184 Lv 1 2 pts. 9,045
  8. Avatar for rinze 108. rinze Lv 1 2 pts. 9,044
  9. Avatar for yasmineahmed 109. yasmineahmed Lv 1 1 pt. 9,016
  10. Avatar for Matroch 110. Matroch Lv 1 1 pt. 9,016

Comments