Placeholder image of a protein
Icon representing a puzzle

2036: Revisiting Puzzle 77: Copper Chaperone

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
August 25, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,366
  2. Avatar for chem2523 assignment 12. chem2523 assignment 1 pt. 8,973
  3. Avatar for Russian team 13. Russian team 1 pt. 8,953
  4. Avatar for Team China 14. Team China 1 pt. 8,387
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 7,685
  6. Avatar for Window Group 16. Window Group 1 pt. 7,646
  7. Avatar for IBS BCS 17. IBS BCS 1 pt. 6,482
  1. Avatar for SHK5P 111. SHK5P Lv 1 1 pt. 8,999
  2. Avatar for kk1999 112. kk1999 Lv 1 1 pt. 8,973
  3. Avatar for jsfoldingaccount 113. jsfoldingaccount Lv 1 1 pt. 8,961
  4. Avatar for parham 114. parham Lv 1 1 pt. 8,953
  5. Avatar for Frances Middleton-Davis 115. Frances Middleton-Davis Lv 1 1 pt. 8,910
  6. Avatar for hkha3895 116. hkha3895 Lv 1 1 pt. 8,895
  7. Avatar for crowns 117. crowns Lv 1 1 pt. 8,885
  8. Avatar for ivalnic 118. ivalnic Lv 1 1 pt. 8,875
  9. Avatar for akad3778 119. akad3778 Lv 1 1 pt. 8,870
  10. Avatar for Karlheinz 120. Karlheinz Lv 1 1 pt. 8,865

Comments