Placeholder image of a protein
Icon representing a puzzle

2036: Revisiting Puzzle 77: Copper Chaperone

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
August 25, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,366
  2. Avatar for chem2523 assignment 12. chem2523 assignment 1 pt. 8,973
  3. Avatar for Russian team 13. Russian team 1 pt. 8,953
  4. Avatar for Team China 14. Team China 1 pt. 8,387
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 7,685
  6. Avatar for Window Group 16. Window Group 1 pt. 7,646
  7. Avatar for IBS BCS 17. IBS BCS 1 pt. 6,482
  1. Avatar for maggiechen 131. maggiechen Lv 1 1 pt. 8,657
  2. Avatar for Mishail919 132. Mishail919 Lv 1 1 pt. 8,653
  3. Avatar for JHAR3259 133. JHAR3259 Lv 1 1 pt. 8,652
  4. Avatar for ihunn 134. ihunn Lv 1 1 pt. 8,638
  5. Avatar for kanders 135. kanders Lv 1 1 pt. 8,617
  6. Avatar for cfaz 136. cfaz Lv 1 1 pt. 8,615
  7. Avatar for MagiPro 137. MagiPro Lv 1 1 pt. 8,589
  8. Avatar for Jenot96 138. Jenot96 Lv 1 1 pt. 8,586
  9. Avatar for agon9279 139. agon9279 Lv 1 1 pt. 8,582
  10. Avatar for fillament 140. fillament Lv 1 1 pt. 8,573

Comments