Placeholder image of a protein
Icon representing a puzzle

2036: Revisiting Puzzle 77: Copper Chaperone

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
August 25, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,366
  2. Avatar for chem2523 assignment 12. chem2523 assignment 1 pt. 8,973
  3. Avatar for Russian team 13. Russian team 1 pt. 8,953
  4. Avatar for Team China 14. Team China 1 pt. 8,387
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 7,685
  6. Avatar for Window Group 16. Window Group 1 pt. 7,646
  7. Avatar for IBS BCS 17. IBS BCS 1 pt. 6,482
  1. Avatar for drumpeter18yrs9yrs 171. drumpeter18yrs9yrs Lv 1 1 pt. 6,482
  2. Avatar for tmai3044 172. tmai3044 Lv 1 1 pt. 6,482
  3. Avatar for hyunjoo 173. hyunjoo Lv 1 1 pt. 6,482
  4. Avatar for Lori R. Scott 174. Lori R. Scott Lv 1 1 pt. 6,482
  5. Avatar for milkshake 175. milkshake Lv 1 1 pt. 6,482
  6. Avatar for jausmh 176. jausmh Lv 1 1 pt. 6,482
  7. Avatar for Erekle 177. Erekle Lv 1 1 pt. 6,482
  8. Avatar for puxatudo 178. puxatudo Lv 1 1 pt. 6,482
  9. Avatar for Adam55000 179. Adam55000 Lv 1 1 pt. 6,482

Comments