Placeholder image of a protein
Icon representing a puzzle

2036: Revisiting Puzzle 77: Copper Chaperone

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
August 25, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,366
  2. Avatar for chem2523 assignment 12. chem2523 assignment 1 pt. 8,973
  3. Avatar for Russian team 13. Russian team 1 pt. 8,953
  4. Avatar for Team China 14. Team China 1 pt. 8,387
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 7,685
  6. Avatar for Window Group 16. Window Group 1 pt. 7,646
  7. Avatar for IBS BCS 17. IBS BCS 1 pt. 6,482
  1. Avatar for gdnskye 11. gdnskye Lv 1 75 pts. 10,083
  2. Avatar for Bletchley Park 12. Bletchley Park Lv 1 73 pts. 10,072
  3. Avatar for Phyx 13. Phyx Lv 1 71 pts. 10,053
  4. Avatar for blazegeek 14. blazegeek Lv 1 69 pts. 10,040
  5. Avatar for silent gene 15. silent gene Lv 1 67 pts. 10,012
  6. Avatar for Bruno Kestemont 16. Bruno Kestemont Lv 1 65 pts. 10,009
  7. Avatar for jobo0502 17. jobo0502 Lv 1 63 pts. 10,009
  8. Avatar for BootsMcGraw 18. BootsMcGraw Lv 1 61 pts. 9,977
  9. Avatar for Crossed Sticks 19. Crossed Sticks Lv 1 59 pts. 9,965
  10. Avatar for johnmitch 20. johnmitch Lv 1 57 pts. 9,951

Comments