Placeholder image of a protein
Icon representing a puzzle

2036: Revisiting Puzzle 77: Copper Chaperone

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
August 25, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,366
  2. Avatar for chem2523 assignment 12. chem2523 assignment 1 pt. 8,973
  3. Avatar for Russian team 13. Russian team 1 pt. 8,953
  4. Avatar for Team China 14. Team China 1 pt. 8,387
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 7,685
  6. Avatar for Window Group 16. Window Group 1 pt. 7,646
  7. Avatar for IBS BCS 17. IBS BCS 1 pt. 6,482
  1. Avatar for maithra 41. maithra Lv 1 29 pts. 9,728
  2. Avatar for kyoota 42. kyoota Lv 1 28 pts. 9,715
  3. Avatar for Trajan464 43. Trajan464 Lv 1 27 pts. 9,709
  4. Avatar for Alistair69 44. Alistair69 Lv 1 26 pts. 9,700
  5. Avatar for matt61ger 45. matt61ger Lv 1 25 pts. 9,696
  6. Avatar for BarrySampson 46. BarrySampson Lv 1 24 pts. 9,694
  7. Avatar for NPrincipi 47. NPrincipi Lv 1 23 pts. 9,676
  8. Avatar for infjamc 48. infjamc Lv 1 22 pts. 9,660
  9. Avatar for Vinara 49. Vinara Lv 1 21 pts. 9,651
  10. Avatar for WBarme1234 50. WBarme1234 Lv 1 20 pts. 9,627

Comments