Placeholder image of a protein
Icon representing a puzzle

2036: Revisiting Puzzle 77: Copper Chaperone

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
August 25, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,366
  2. Avatar for chem2523 assignment 12. chem2523 assignment 1 pt. 8,973
  3. Avatar for Russian team 13. Russian team 1 pt. 8,953
  4. Avatar for Team China 14. Team China 1 pt. 8,387
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 7,685
  6. Avatar for Window Group 16. Window Group 1 pt. 7,646
  7. Avatar for IBS BCS 17. IBS BCS 1 pt. 6,482
  1. Avatar for dahast.de 51. dahast.de Lv 1 20 pts. 9,613
  2. Avatar for phi16 52. phi16 Lv 1 19 pts. 9,612
  3. Avatar for Deleted player 53. Deleted player pts. 9,608
  4. Avatar for Simek 54. Simek Lv 1 18 pts. 9,595
  5. Avatar for zem 55. zem Lv 1 17 pts. 9,550
  6. Avatar for kentish_alex 56. kentish_alex Lv 1 16 pts. 9,544
  7. Avatar for joaniegirl 57. joaniegirl Lv 1 16 pts. 9,514
  8. Avatar for MirsadaH 58. MirsadaH Lv 1 15 pts. 9,483
  9. Avatar for heather-1 59. heather-1 Lv 1 14 pts. 9,481
  10. Avatar for fpc 60. fpc Lv 1 14 pts. 9,473

Comments