Placeholder image of a protein
Icon representing a puzzle

2036: Revisiting Puzzle 77: Copper Chaperone

Closed since over 4 years ago

Novice Overall Prediction

Summary


Created
August 25, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,366
  2. Avatar for chem2523 assignment 12. chem2523 assignment 1 pt. 8,973
  3. Avatar for Russian team 13. Russian team 1 pt. 8,953
  4. Avatar for Team China 14. Team China 1 pt. 8,387
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 7,685
  6. Avatar for Window Group 16. Window Group 1 pt. 7,646
  7. Avatar for IBS BCS 17. IBS BCS 1 pt. 6,482

  1. Avatar for fishercat 81. fishercat Lv 1 6 pts. 9,291
  2. Avatar for Squirrely 82. Squirrely Lv 1 5 pts. 9,287
  3. Avatar for hada 83. hada Lv 1 5 pts. 9,284
  4. Avatar for pfirth 84. pfirth Lv 1 5 pts. 9,278
  5. Avatar for alcor29 85. alcor29 Lv 1 5 pts. 9,277
  6. Avatar for toshiue 86. toshiue Lv 1 4 pts. 9,272
  7. Avatar for Deleted player 87. Deleted player 4 pts. 9,267
  8. Avatar for ManVsYard 88. ManVsYard Lv 1 4 pts. 9,261
  9. Avatar for EmmyBee 89. EmmyBee Lv 1 4 pts. 9,252
  10. Avatar for Todd6485577 90. Todd6485577 Lv 1 4 pts. 9,252

Comments