Placeholder image of a protein
Icon representing a puzzle

2036: Revisiting Puzzle 77: Copper Chaperone

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
August 25, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,384
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 73 pts. 10,381
  3. Avatar for Marvin's bunch 3. Marvin's bunch 52 pts. 10,184
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 36 pts. 10,103
  5. Avatar for Contenders 5. Contenders 24 pts. 10,072
  6. Avatar for Go Science 6. Go Science 16 pts. 10,071
  7. Avatar for SETI.Germany 7. SETI.Germany 10 pts. 9,613
  8. Avatar for Void Crushers 8. Void Crushers 6 pts. 9,595
  9. Avatar for Australia 9. Australia 4 pts. 9,429
  10. Avatar for Gargleblasters 10. Gargleblasters 2 pts. 9,416
  1. Avatar for dcrwheeler 21. dcrwheeler Lv 1 56 pts. 9,930
  2. Avatar for Deleted player 22. Deleted player pts. 9,928
  3. Avatar for drjr 23. drjr Lv 1 52 pts. 9,898
  4. Avatar for Maerlyn138 24. Maerlyn138 Lv 1 51 pts. 9,894
  5. Avatar for stomjoh 25. stomjoh Lv 1 49 pts. 9,886
  6. Avatar for guineapig 26. guineapig Lv 1 47 pts. 9,885
  7. Avatar for nicobul 27. nicobul Lv 1 46 pts. 9,875
  8. Avatar for Sciren 28. Sciren Lv 1 44 pts. 9,864
  9. Avatar for NinjaGreg 29. NinjaGreg Lv 1 43 pts. 9,861
  10. Avatar for PeterDav 30. PeterDav Lv 1 42 pts. 9,851

Comments