Placeholder image of a protein
Icon representing a puzzle

2036: Revisiting Puzzle 77: Copper Chaperone

Closed since over 4 years ago

Novice Novice Novice Novice Overall Overall Overall Overall Prediction Prediction Prediction Prediction

Summary


Created
August 25, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups


  1. Avatar for Beta Folders 100 pts. 10,384
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 73 pts. 10,381
  3. Avatar for Marvin's bunch 3. Marvin's bunch 52 pts. 10,184
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 36 pts. 10,103
  5. Avatar for Contenders 5. Contenders 24 pts. 10,072
  6. Avatar for Go Science 6. Go Science 16 pts. 10,071
  7. Avatar for SETI.Germany 7. SETI.Germany 10 pts. 9,613
  8. Avatar for Void Crushers 8. Void Crushers 6 pts. 9,595
  9. Avatar for Australia 9. Australia 4 pts. 9,429
  10. Avatar for Gargleblasters 10. Gargleblasters 2 pts. 9,416

  1. Avatar for Visok 61. Visok Lv 1 13 pts. 9,456
  2. Avatar for equilibria 62. equilibria Lv 1 13 pts. 9,442
  3. Avatar for Wiz kid 63. Wiz kid Lv 1 12 pts. 9,429
  4. Avatar for Kiwegapa 64. Kiwegapa Lv 1 12 pts. 9,420
  5. Avatar for AlkiP0Ps 65. AlkiP0Ps Lv 1 11 pts. 9,416
  6. Avatar for antibot215 66. antibot215 Lv 1 11 pts. 9,416
  7. Avatar for Lotus23 67. Lotus23 Lv 1 10 pts. 9,403
  8. Avatar for Oransche 68. Oransche Lv 1 10 pts. 9,386
  9. Avatar for rezaefar 69. rezaefar Lv 1 10 pts. 9,382
  10. Avatar for argyrw 70. argyrw Lv 1 9 pts. 9,368

Comments