Placeholder image of a protein
Icon representing a puzzle

2042: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
September 09, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 2 pts. 10,105
  2. Avatar for Ogre's lab 12. Ogre's lab 1 pt. 10,068
  3. Avatar for Australia 13. Australia 1 pt. 10,034
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 9,885
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 9,819
  6. Avatar for Weber CHM3010 F2020 16. Weber CHM3010 F2020 1 pt. 8,953
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 8,600
  8. Avatar for Window Group 18. Window Group 1 pt. 4,734
  1. Avatar for carxo 121. carxo Lv 1 1 pt. 9,244
  2. Avatar for Belle36 122. Belle36 Lv 1 1 pt. 9,242
  3. Avatar for E Folder 123. E Folder Lv 1 1 pt. 9,224
  4. Avatar for Rose621 124. Rose621 Lv 1 1 pt. 9,204
  5. Avatar for shariahagomez 125. shariahagomez Lv 1 1 pt. 9,175
  6. Avatar for avalladolid 126. avalladolid Lv 1 1 pt. 9,172
  7. Avatar for soilmate 127. soilmate Lv 1 1 pt. 9,135
  8. Avatar for Swapper242 128. Swapper242 Lv 1 1 pt. 9,095
  9. Avatar for taewookim 129. taewookim Lv 1 1 pt. 9,088
  10. Avatar for Arne Heessels 130. Arne Heessels Lv 1 1 pt. 9,052

Comments