Placeholder image of a protein
Icon representing a puzzle

2042: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
September 09, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 10,735
  2. Avatar for Go Science 2. Go Science 74 pts. 10,728
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 10,661
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 10,614
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 27 pts. 10,607
  6. Avatar for Contenders 6. Contenders 18 pts. 10,595
  7. Avatar for Marvin's bunch 7. Marvin's bunch 12 pts. 10,574
  8. Avatar for AlphaFold 8. AlphaFold 8 pts. 10,552
  9. Avatar for Kotocycle 9. Kotocycle 5 pts. 10,190
  10. Avatar for Czech National Team 10. Czech National Team 3 pts. 10,122
  1. Avatar for carxo 121. carxo Lv 1 1 pt. 9,244
  2. Avatar for Belle36 122. Belle36 Lv 1 1 pt. 9,242
  3. Avatar for E Folder 123. E Folder Lv 1 1 pt. 9,224
  4. Avatar for Rose621 124. Rose621 Lv 1 1 pt. 9,204
  5. Avatar for shariahagomez 125. shariahagomez Lv 1 1 pt. 9,175
  6. Avatar for avalladolid 126. avalladolid Lv 1 1 pt. 9,172
  7. Avatar for soilmate 127. soilmate Lv 1 1 pt. 9,135
  8. Avatar for Swapper242 128. Swapper242 Lv 1 1 pt. 9,095
  9. Avatar for taewookim 129. taewookim Lv 1 1 pt. 9,088
  10. Avatar for Arne Heessels 130. Arne Heessels Lv 1 1 pt. 9,052

Comments