Placeholder image of a protein
Icon representing a puzzle

2042: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
September 09, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 2 pts. 10,105
  2. Avatar for Ogre's lab 12. Ogre's lab 1 pt. 10,068
  3. Avatar for Australia 13. Australia 1 pt. 10,034
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 9,885
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 9,819
  6. Avatar for Weber CHM3010 F2020 16. Weber CHM3010 F2020 1 pt. 8,953
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 8,600
  8. Avatar for Window Group 18. Window Group 1 pt. 4,734
  1. Avatar for gmn 11. gmn Lv 1 72 pts. 10,578
  2. Avatar for frood66 12. frood66 Lv 1 70 pts. 10,574
  3. Avatar for drjr 13. drjr Lv 1 68 pts. 10,568
  4. Avatar for Galaxie 14. Galaxie Lv 1 65 pts. 10,566
  5. Avatar for NeLikomSheet 15. NeLikomSheet Lv 1 63 pts. 10,556
  6. Avatar for AlphaFold2 16. AlphaFold2 Lv 1 61 pts. 10,552
  7. Avatar for Skippysk8s 17. Skippysk8s Lv 1 59 pts. 10,488
  8. Avatar for grogar7 18. grogar7 Lv 1 57 pts. 10,481
  9. Avatar for georg137 19. georg137 Lv 1 55 pts. 10,481
  10. Avatar for nicobul 20. nicobul Lv 1 53 pts. 10,456

Comments