Placeholder image of a protein
Icon representing a puzzle

2042: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
September 09, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 10,735
  2. Avatar for Go Science 2. Go Science 74 pts. 10,728
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 10,661
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 10,614
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 27 pts. 10,607
  6. Avatar for Contenders 6. Contenders 18 pts. 10,595
  7. Avatar for Marvin's bunch 7. Marvin's bunch 12 pts. 10,574
  8. Avatar for AlphaFold 8. AlphaFold 8 pts. 10,552
  9. Avatar for Kotocycle 9. Kotocycle 5 pts. 10,190
  10. Avatar for Czech National Team 10. Czech National Team 3 pts. 10,122
  1. Avatar for gmn 11. gmn Lv 1 72 pts. 10,578
  2. Avatar for frood66 12. frood66 Lv 1 70 pts. 10,574
  3. Avatar for drjr 13. drjr Lv 1 68 pts. 10,568
  4. Avatar for Galaxie 14. Galaxie Lv 1 65 pts. 10,566
  5. Avatar for NeLikomSheet 15. NeLikomSheet Lv 1 63 pts. 10,556
  6. Avatar for AlphaFold2 16. AlphaFold2 Lv 1 61 pts. 10,552
  7. Avatar for Skippysk8s 17. Skippysk8s Lv 1 59 pts. 10,488
  8. Avatar for grogar7 18. grogar7 Lv 1 57 pts. 10,481
  9. Avatar for georg137 19. georg137 Lv 1 55 pts. 10,481
  10. Avatar for nicobul 20. nicobul Lv 1 53 pts. 10,456

Comments