Placeholder image of a protein
Icon representing a puzzle

2042: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
September 09, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 2 pts. 10,105
  2. Avatar for Ogre's lab 12. Ogre's lab 1 pt. 10,068
  3. Avatar for Australia 13. Australia 1 pt. 10,034
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 9,885
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 9,819
  6. Avatar for Weber CHM3010 F2020 16. Weber CHM3010 F2020 1 pt. 8,953
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 8,600
  8. Avatar for Window Group 18. Window Group 1 pt. 4,734
  1. Avatar for jobo0502 21. jobo0502 Lv 1 51 pts. 10,448
  2. Avatar for Bletchley Park 22. Bletchley Park Lv 1 49 pts. 10,443
  3. Avatar for Maerlyn138 23. Maerlyn138 Lv 1 48 pts. 10,435
  4. Avatar for robgee 24. robgee Lv 1 46 pts. 10,416
  5. Avatar for fiendish_ghoul 25. fiendish_ghoul Lv 1 44 pts. 10,401
  6. Avatar for akaaka 26. akaaka Lv 1 43 pts. 10,390
  7. Avatar for phi16 27. phi16 Lv 1 41 pts. 10,390
  8. Avatar for silent gene 28. silent gene Lv 1 39 pts. 10,375
  9. Avatar for neon_fuzz 29. neon_fuzz Lv 1 38 pts. 10,374
  10. Avatar for johnmitch 30. johnmitch Lv 1 37 pts. 10,357

Comments