Placeholder image of a protein
Icon representing a puzzle

2042: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
September 09, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 10,735
  2. Avatar for Go Science 2. Go Science 74 pts. 10,728
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 10,661
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 10,614
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 27 pts. 10,607
  6. Avatar for Contenders 6. Contenders 18 pts. 10,595
  7. Avatar for Marvin's bunch 7. Marvin's bunch 12 pts. 10,574
  8. Avatar for AlphaFold 8. AlphaFold 8 pts. 10,552
  9. Avatar for Kotocycle 9. Kotocycle 5 pts. 10,190
  10. Avatar for Czech National Team 10. Czech National Team 3 pts. 10,122
  1. Avatar for jobo0502 21. jobo0502 Lv 1 51 pts. 10,448
  2. Avatar for Bletchley Park 22. Bletchley Park Lv 1 49 pts. 10,443
  3. Avatar for Maerlyn138 23. Maerlyn138 Lv 1 48 pts. 10,435
  4. Avatar for robgee 24. robgee Lv 1 46 pts. 10,416
  5. Avatar for fiendish_ghoul 25. fiendish_ghoul Lv 1 44 pts. 10,401
  6. Avatar for akaaka 26. akaaka Lv 1 43 pts. 10,390
  7. Avatar for phi16 27. phi16 Lv 1 41 pts. 10,390
  8. Avatar for silent gene 28. silent gene Lv 1 39 pts. 10,375
  9. Avatar for neon_fuzz 29. neon_fuzz Lv 1 38 pts. 10,374
  10. Avatar for johnmitch 30. johnmitch Lv 1 37 pts. 10,357

Comments