Placeholder image of a protein
Icon representing a puzzle

2042: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
September 09, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 2 pts. 10,105
  2. Avatar for Ogre's lab 12. Ogre's lab 1 pt. 10,068
  3. Avatar for Australia 13. Australia 1 pt. 10,034
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 9,885
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 9,819
  6. Avatar for Weber CHM3010 F2020 16. Weber CHM3010 F2020 1 pt. 8,953
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 8,600
  8. Avatar for Window Group 18. Window Group 1 pt. 4,734
  1. Avatar for pascal ochem 51. pascal ochem Lv 1 15 pts. 10,180
  2. Avatar for a5hm0r 52. a5hm0r Lv 1 15 pts. 10,179
  3. Avatar for manu8170 53. manu8170 Lv 1 14 pts. 10,176
  4. Avatar for tracybutt 54. tracybutt Lv 1 13 pts. 10,172
  5. Avatar for Flagg65a 55. Flagg65a Lv 1 13 pts. 10,172
  6. Avatar for toshiue 56. toshiue Lv 1 12 pts. 10,160
  7. Avatar for charliegs 57. charliegs Lv 1 12 pts. 10,152
  8. Avatar for alcor29 58. alcor29 Lv 1 11 pts. 10,150
  9. Avatar for avogadro.toast 59. avogadro.toast Lv 1 10 pts. 10,144
  10. Avatar for maithra 60. maithra Lv 1 10 pts. 10,141

Comments