Placeholder image of a protein
Icon representing a puzzle

2042: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
September 09, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 10,735
  2. Avatar for Go Science 2. Go Science 74 pts. 10,728
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 10,661
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 10,614
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 27 pts. 10,607
  6. Avatar for Contenders 6. Contenders 18 pts. 10,595
  7. Avatar for Marvin's bunch 7. Marvin's bunch 12 pts. 10,574
  8. Avatar for AlphaFold 8. AlphaFold 8 pts. 10,552
  9. Avatar for Kotocycle 9. Kotocycle 5 pts. 10,190
  10. Avatar for Czech National Team 10. Czech National Team 3 pts. 10,122
  1. Avatar for pascal ochem 51. pascal ochem Lv 1 15 pts. 10,180
  2. Avatar for a5hm0r 52. a5hm0r Lv 1 15 pts. 10,179
  3. Avatar for manu8170 53. manu8170 Lv 1 14 pts. 10,176
  4. Avatar for tracybutt 54. tracybutt Lv 1 13 pts. 10,172
  5. Avatar for Flagg65a 55. Flagg65a Lv 1 13 pts. 10,172
  6. Avatar for toshiue 56. toshiue Lv 1 12 pts. 10,160
  7. Avatar for charliegs 57. charliegs Lv 1 12 pts. 10,152
  8. Avatar for alcor29 58. alcor29 Lv 1 11 pts. 10,150
  9. Avatar for avogadro.toast 59. avogadro.toast Lv 1 10 pts. 10,144
  10. Avatar for maithra 60. maithra Lv 1 10 pts. 10,141

Comments