Placeholder image of a protein
Icon representing a puzzle

2042: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
September 09, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 2 pts. 10,105
  2. Avatar for Ogre's lab 12. Ogre's lab 1 pt. 10,068
  3. Avatar for Australia 13. Australia 1 pt. 10,034
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 9,885
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 9,819
  6. Avatar for Weber CHM3010 F2020 16. Weber CHM3010 F2020 1 pt. 8,953
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 8,600
  8. Avatar for Window Group 18. Window Group 1 pt. 4,734
  1. Avatar for bamh 61. bamh Lv 1 10 pts. 10,139
  2. Avatar for vybi 62. vybi Lv 1 9 pts. 10,122
  3. Avatar for kentish_alex 63. kentish_alex Lv 1 9 pts. 10,115
  4. Avatar for Simek 64. Simek Lv 1 8 pts. 10,105
  5. Avatar for fishercat 65. fishercat Lv 1 8 pts. 10,104
  6. Avatar for Museka 66. Museka Lv 1 7 pts. 10,095
  7. Avatar for Evica 67. Evica Lv 1 7 pts. 10,080
  8. Avatar for heather-1 68. heather-1 Lv 1 7 pts. 10,071
  9. Avatar for Holp 69. Holp Lv 1 6 pts. 10,068
  10. Avatar for Vinara 70. Vinara Lv 1 6 pts. 10,050

Comments