Placeholder image of a protein
Icon representing a puzzle

2042: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 4 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
September 09, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Gargleblasters 100 pts. 10,735
  2. Avatar for Go Science 2. Go Science 74 pts. 10,728
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 10,661
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 10,614
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 27 pts. 10,607
  6. Avatar for Contenders 6. Contenders 18 pts. 10,595
  7. Avatar for Marvin's bunch 7. Marvin's bunch 12 pts. 10,574
  8. Avatar for AlphaFold 8. AlphaFold 8 pts. 10,552
  9. Avatar for Kotocycle 9. Kotocycle 5 pts. 10,190
  10. Avatar for Czech National Team 10. Czech National Team 3 pts. 10,122

  1. Avatar for bamh 61. bamh Lv 1 10 pts. 10,139
  2. Avatar for vybi 62. vybi Lv 1 9 pts. 10,122
  3. Avatar for kentish_alex 63. kentish_alex Lv 1 9 pts. 10,115
  4. Avatar for Simek 64. Simek Lv 1 8 pts. 10,105
  5. Avatar for fishercat 65. fishercat Lv 1 8 pts. 10,104
  6. Avatar for Museka 66. Museka Lv 1 7 pts. 10,095
  7. Avatar for Evica 67. Evica Lv 1 7 pts. 10,080
  8. Avatar for heather-1 68. heather-1 Lv 1 7 pts. 10,071
  9. Avatar for Holp 69. Holp Lv 1 6 pts. 10,068
  10. Avatar for Vinara 70. Vinara Lv 1 6 pts. 10,050

Comments